Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.1: Resolvase-like [53041] (2 families) |
Family c.53.1.2: 5' to 3' exonuclease [53045] (4 proteins) contains additional strand and alpha-helical arch; strand order 321456; strand 6 is antiparallel to the rest |
Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species) |
Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries) |
Domain d1bgxt2: 1bgx T:1-173 [33353] Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt3, d1bgxt4 |
PDB Entry: 1bgx (more details), 2.3 Å
SCOP Domain Sequences for d1bgxt2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bgxt2 c.53.1.2 (T:1-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus} mrgmlplfepkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgd avivvfdakapsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeadd vlaslakkaekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg
Timeline for d1bgxt2:
View in 3D Domains from other chains: (mouse over for more information) d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2 |