Lineage for d1bgxt2 (1bgx T:1-173)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245914Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 245915Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 245927Family c.53.1.2: 5' to 3' exonuclease [53045] (4 proteins)
    contains additional strand and alpha-helical arch; strand order 321456; strand 6 is antiparallel to the rest
  6. 245928Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species)
  7. 245929Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries)
  8. 245930Domain d1bgxt2: 1bgx T:1-173 [33353]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt3, d1bgxt4

Details for d1bgxt2

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxt2 c.53.1.2 (T:1-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
mrgmlplfepkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgd
avivvfdakapsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeadd
vlaslakkaekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg

SCOP Domain Coordinates for d1bgxt2:

Click to download the PDB-style file with coordinates for d1bgxt2.
(The format of our PDB-style files is described here.)

Timeline for d1bgxt2: