![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries) |
![]() | Domain d5nkqg_: 5nkq G: [333524] automated match to d5a41g_ complexed with f, na |
PDB Entry: 5nkq (more details), 2.17 Å
SCOPe Domain Sequences for d5nkqg_:
Sequence, based on SEQRES records: (download)
>d5nkqg_ b.1.2.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstati sglkpgvdytitvyayydsyghwspisinyrt
>d5nkqg_ b.1.2.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svssvptklevvaatptslliswdayydevmyyritygetpvqeftvpgssstatisglk pgvdytitvyayydsyghwspisinyrt
Timeline for d5nkqg_: