SCOPe 2.06: Domain d5tnob_: 5tno B:

Lineage for d5tnob_ (5tno B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries)

8. Domain d5tnob_: 5tno B: [333523]
   Other proteins in same PDB: d5tnoa_
   automated match to d2wphe_
   complexed with na, nhe, unl

Details for d5tnob_

PDB Entry: 5tno, 1.54 Å

PDB Description: discovery of novel aminobenzisoxazole derivatives as orally available factor ixa inhibitors

PDB Compounds: (B:) coagulation factor ix

SCOPe Domain Sequences for d5tnob_:

Sequence; same for both SEQRES and ATOM records:

>d5tnob_ g.3.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsq

Timeline for d5tnob_:

• d5tnob_ is new in SCOPe 2.06-stable
  
• d5tnob_ appears in SCOPe 2.07
  
• d5tnob_ appears in the current release, SCOPe 2.08