Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
Protein 5' to 3' exonuclease domain of DNA polymerase Taq [53048] (1 species) |
Species Thermus aquaticus [TaxId:271] [53049] (4 PDB entries) |
Domain d1taqa2: 1taq A:10-173 [33352] Other proteins in same PDB: d1taqa1, d1taqa3, d1taqa4 complexed with bgl, zn |
PDB Entry: 1taq (more details), 2.4 Å
SCOPe Domain Sequences for d1taqa2:
Sequence, based on SEQRES records: (download)
>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdak apsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeaddvlaslakka ekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyg
>d1taqa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl yqllsdrihvlhpegylitpawlwekyg
Timeline for d1taqa2: