Lineage for d5tica1 (5tic A:2-177)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440037Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2440091Family c.23.10.5: TAP-like [89594] (3 protein domains)
    automatically mapped to Pfam PF00657
    automatically mapped to Pfam PF13472
  6. 2440102Protein automated matches [333488] (1 species)
    not a true protein
  7. 2440103Species Escherichia coli [TaxId:562] [333489] (4 PDB entries)
  8. 2440107Domain d5tica1: 5tic A:2-177 [333505]
    Other proteins in same PDB: d5tica2, d5ticb2
    automated match to d1ivna_
    complexed with cl

Details for d5tica1

PDB Entry: 5tic (more details), 1.65 Å

PDB Description: x-ray structure of wild-type e. coli acyl-coa thioesterase i at ph 5
PDB Compounds: (A:) Acyl-CoA Thioesterase I

SCOPe Domain Sequences for d5tica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tica1 c.23.10.5 (A:2-177) automated matches {Escherichia coli [TaxId: 562]}
dtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqpl

SCOPe Domain Coordinates for d5tica1:

Click to download the PDB-style file with coordinates for d5tica1.
(The format of our PDB-style files is described here.)

Timeline for d5tica1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tica2