SCOPe 2.06: Domain d5txqa2: 5txq A:444-748

Lineage for d5txqa2 (5txq A:444-748)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein automated matches [227103] (4 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)

8. Domain d5txqa2: 5txq A:444-748 [333501]
   automated match to d3n3ra2
   complexed with hem, mpd, na, oxy, po4

Details for d5txqa2

PDB Entry: 5txq, 1.9 Å

PDB Description: crystal structure of the a143d variant of catalase-peroxidase from b. pseudomallei

PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5txqa2:

Sequence; same for both SEQRES and ATOM records:

>d5txqa2 a.93.1.3 (A:444-748) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

Timeline for d5txqa2:

• d5txqa2 is new in SCOPe 2.06-stable
  
• d5txqa2 appears in SCOPe 2.07
  
• d5txqa2 appears in the current release, SCOPe 2.08