Lineage for d1gdtb2 (1gdt B:1-140)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490902Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2490903Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2490904Family c.53.1.1: gamma,delta resolvase, catalytic domain [53042] (1 protein)
  6. 2490905Protein gamma,delta resolvase, catalytic domain [53043] (1 species)
  7. 2490906Species Escherichia coli [TaxId:562] [53044] (9 PDB entries)
  8. 2490915Domain d1gdtb2: 1gdt B:1-140 [33349]
    Other proteins in same PDB: d1gdta1, d1gdtb1
    protein/DNA complex

Details for d1gdtb2

PDB Entry: 1gdt (more details), 3 Å

PDB Description: crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site
PDB Compounds: (B:) protein (gamma delta resolvase)

SCOPe Domain Sequences for d1gdtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdtb2 c.53.1.1 (B:1-140) gamma,delta resolvase, catalytic domain {Escherichia coli [TaxId: 562]}
mrlfgyarvstsqqsldiqvralkdagvkanriftdkasgsssdrkgldllrmkveegdv
ilvkkldrlgrdtadmiqlikefdaqgvsirfiddgistdgemgkmvvtilsavaqaerq
rilertnegrqeamakgvvf

SCOPe Domain Coordinates for d1gdtb2:

Click to download the PDB-style file with coordinates for d1gdtb2.
(The format of our PDB-style files is described here.)

Timeline for d1gdtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gdtb1