Lineage for d5ju7a1 (5ju7 A:2-107)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695343Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries)
  8. 2695346Domain d5ju7a1: 5ju7 A:2-107 [333480]
    Other proteins in same PDB: d5ju7a2
    automated match to d4nhjb_
    complexed with zn

Details for d5ju7a1

PDB Entry: 5ju7 (more details), 2.05 Å

PDB Description: dna binding domain of e.coli cadc
PDB Compounds: (A:) Transcriptional activator cadC

SCOPe Domain Sequences for d5ju7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ju7a1 a.4.6.0 (A:2-107) automated matches {Escherichia coli [TaxId: 83333]}
qqpvvrvgewlvtpsinqisrngrqltleprlidllvffaqhsgevlsrdelidnvwkrs
ivtnhvvtqsiselrkslkdndedspvyiatvpkrgyklmvpviwy

SCOPe Domain Coordinates for d5ju7a1:

Click to download the PDB-style file with coordinates for d5ju7a1.
(The format of our PDB-style files is described here.)

Timeline for d5ju7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ju7a2