![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (25 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries) |
![]() | Domain d5ju7a1: 5ju7 A:2-107 [333480] Other proteins in same PDB: d5ju7a2 automated match to d4nhjb_ complexed with zn |
PDB Entry: 5ju7 (more details), 2.05 Å
SCOPe Domain Sequences for d5ju7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ju7a1 a.4.6.0 (A:2-107) automated matches {Escherichia coli [TaxId: 83333]} qqpvvrvgewlvtpsinqisrngrqltleprlidllvffaqhsgevlsrdelidnvwkrs ivtnhvvtqsiselrkslkdndedspvyiatvpkrgyklmvpviwy
Timeline for d5ju7a1: