SCOPe 2.08: Domain d5ju7a1: 5ju7 A:2-107

Lineage for d5ju7a1 (5ju7 A:2-107)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [315476] (2 PDB entries)

8. Domain d5ju7a1: 5ju7 A:2-107 [333480]
   Other proteins in same PDB: d5ju7a2
   automated match to d4nhjb_
   complexed with zn

Details for d5ju7a1

PDB Entry: 5ju7, 2.05 Å

PDB Description: dna binding domain of e.coli cadc

PDB Compounds: (A:) Transcriptional activator cadC

SCOPe Domain Sequences for d5ju7a1:

Sequence; same for both SEQRES and ATOM records:

>d5ju7a1 a.4.6.0 (A:2-107) automated matches {Escherichia coli [TaxId: 83333]}
qqpvvrvgewlvtpsinqisrngrqltleprlidllvffaqhsgevlsrdelidnvwkrs
ivtnhvvtqsiselrkslkdndedspvyiatvpkrgyklmvpviwy

Timeline for d5ju7a1:

• d5ju7a1 first appeared in SCOPe 2.06
  
• d5ju7a1 appears in SCOPe 2.07