SCOPe 2.08: Domain d5mp7a1: 5mp7 A:10-168

Lineage for d5mp7a1 (5mp7 A:10-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [333421] (1 PDB entry)

8. Domain d5mp7a1: 5mp7 A:10-168 [333455]
   automated match to d3s5ja1
   complexed with act

Details for d5mp7a1

PDB Entry: 5mp7, 2.4 Å

PDB Description: crystal structure of phosphoribosylpyrophosphate synthetase from mycobacterium smegmatis

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5mp7a1:

Sequence; same for both SEQRES and ATOM records:

>d5mp7a1 c.61.1.0 (A:10-168) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
knlmlfagrahpeladqvakeldvavtaqtardfangeifvrfdesvrgcdafvlqshpa
plnqwlmeqlimidalkrgsakritailpfypyarqdkkhrgrepisarlvadllktaga
drivsvdlhtdqiqgffdgpvdhmraqklltgyigehya

Timeline for d5mp7a1:

• d5mp7a1 first appeared in SCOPe 2.06
  
• d5mp7a1 appears in SCOPe 2.07