SCOPe 2.07: Domain d5k4ka_: 5k4k A:

Lineage for d5k4ka_ (5k4k A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d5k4ka_: 5k4k A: [333452]
   automated match to d4eyba_
   complexed with mes, mg, npo, sv7, zn

Details for d5k4ka_

PDB Entry: 5k4k, 1.76 Å

PDB Description: directed evolutionary changes in mbl super family - ndm-1 round 10 crystal-4

PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5k4ka_:

Sequence; same for both SEQRES and ATOM records:

>d5k4ka_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dqrfgdpvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlmvdtagtdaqtaqil
kwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapregvvaaqhslt
faatgwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslgnld
eadtehyaasvrafgaafpkasmivmshfapdsraaithtarmadklr

Timeline for d5k4ka_:

• d5k4ka_ first appeared in SCOPe 2.06
  
• d5k4ka_ appears in the current release, SCOPe 2.08