Lineage for d5nkqe_ (5nkq E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762308Domain d5nkqe_: 5nkq E: [333441]
    automated match to d5a41g_
    complexed with f, na

Details for d5nkqe_

PDB Entry: 5nkq (more details), 2.17 Å

PDB Description: crystal structure of a dual topology fluoride ion channel.
PDB Compounds: (E:) monobody

SCOPe Domain Sequences for d5nkqe_:

Sequence, based on SEQRES records: (download)

>d5nkqe_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgssstatisg
lkpgvdytitvyayydsyghwspisinyrt

Sequence, based on observed residues (ATOM records): (download)

>d5nkqe_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssvptklevvaatptslliswdayydevmyyritygetspvqeftvpgssstatisglkp
gvdytitvyayydsyghwspisinyrt

SCOPe Domain Coordinates for d5nkqe_:

Click to download the PDB-style file with coordinates for d5nkqe_.
(The format of our PDB-style files is described here.)

Timeline for d5nkqe_: