| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d1dzfa1: 1dzf A:5-143 [33344] Other proteins in same PDB: d1dzfa2 |
PDB Entry: 1dzf (more details), 1.9 Å
SCOPe Domain Sequences for d1dzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzfa1 c.52.3.1 (A:5-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqanp
teesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamklv
psippatietfneaalvvn
Timeline for d1dzfa1: