Lineage for d1dzfa1 (1dzf A:5-143)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136828Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2136829Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2136830Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2136831Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2136832Domain d1dzfa1: 1dzf A:5-143 [33344]
    Other proteins in same PDB: d1dzfa2

Details for d1dzfa1

PDB Entry: 1dzf (more details), 1.9 Å

PDB Description: RPB5 from S.cerevisiae
PDB Compounds: (A:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d1dzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzfa1 c.52.3.1 (A:5-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqanp
teesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamklv
psippatietfneaalvvn

SCOPe Domain Coordinates for d1dzfa1:

Click to download the PDB-style file with coordinates for d1dzfa1.
(The format of our PDB-style files is described here.)

Timeline for d1dzfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dzfa2