Lineage for d1a79d1 (1a79 D:83-179)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24936Superfamily c.52.2: tRNA splicing endonuclease, C-terminal domain [53032] (1 family) (S)
  5. 24937Family c.52.2.1: tRNA splicing endonuclease, C-terminal domain [53033] (1 protein)
  6. 24938Protein tRNA splicing endonuclease, C-terminal domain [53034] (1 species)
  7. 24939Species Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry)
  8. 24943Domain d1a79d1: 1a79 D:83-179 [33343]
    Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2

Details for d1a79d1

PDB Entry: 1a79 (more details), 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii

SCOP Domain Sequences for d1a79d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a79d1 c.52.2.1 (D:83-179) tRNA splicing endonuclease, C-terminal domain {Methanococcus jannaschii}
erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls
eltgfvrvahsvrkklliaivdadgdivyynmtyvkp

SCOP Domain Coordinates for d1a79d1:

Click to download the PDB-style file with coordinates for d1a79d1.
(The format of our PDB-style files is described here.)

Timeline for d1a79d1: