SCOPe 2.07: Domain d5jhha2: 5jhh A:942-1081

Lineage for d5jhha2 (5jhh A:942-1081)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [117254] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117255] (5 PDB entries)
   Uniprot O15085 714-1081

8. Domain d5jhha2: 5jhh A:942-1081 [333425]
   Other proteins in same PDB: d5jhha1, d5jhhb_, d5jhhe1, d5jhhf_
   automated match to d1xcga2
   complexed with gol, ra0

Details for d5jhha2

PDB Entry: 5jhh, 2.3 Å

PDB Description: crystal structure of the ternary complex between the human rhoa, its inhibitor and the dh/ph domain of human arhgef11

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d5jhha2:

Sequence, based on SEQRES records:

>d5jhha2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktavgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelva
ltssdkntwmelleeavrna

Sequence, based on observed residues (ATOM records):

>d5jhha2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchtfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwmel
leeavrna

Timeline for d5jhha2:

• d5jhha2 first appeared in SCOPe 2.06
  
• d5jhha2 appears in the current release, SCOPe 2.08