![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
![]() | Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) ![]() automatically mapped to Pfam PF00621 |
![]() | Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins) Pfam PF00621 |
![]() | Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries) Uniprot O15085 714-1081 |
![]() | Domain d5jhha1: 5jhh A:714-941 [333424] Other proteins in same PDB: d5jhha2, d5jhhb_, d5jhhe2, d5jhhf_ automated match to d1xcga1 complexed with gol, ra0 |
PDB Entry: 5jhh (more details), 2.3 Å
SCOPe Domain Sequences for d5jhha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhha1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld
Timeline for d5jhha1:
![]() Domains from other chains: (mouse over for more information) d5jhhb_, d5jhhe1, d5jhhe2, d5jhhf_ |