Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [333421] (1 PDB entry) |
Domain d5mp7c2: 5mp7 C:169-316 [333423] automated match to d4f8ea2 complexed with act |
PDB Entry: 5mp7 (more details), 2.4 Å
SCOPe Domain Sequences for d5mp7c2:
Sequence, based on SEQRES records: (download)
>d5mp7c2 c.61.1.0 (C:169-316) automated matches {Mycobacterium smegmatis [TaxId: 246196]} dedmvvvspdsgrvrvaekwadslggvplafihktrdplvpnqvksnrvvgdvkgktcil tddmidtggtiagavnllredgakdviiaathgvlsdpapqrlaecgarevivtntlpit edkrfpqltvlsiapllantiravfeng
>d5mp7c2 c.61.1.0 (C:169-316) automated matches {Mycobacterium smegmatis [TaxId: 246196]} dedmvvvspdsgrvrvaekwadslggvplafihktrsnrvvgdvkgktciltddmidtgg tiagavnllredgakdviiaathgvlsdpapqrlaecgarevivtntlpitedkrfpqlt vlsiapllantiravfeng
Timeline for d5mp7c2:
View in 3D Domains from other chains: (mouse over for more information) d5mp7a1, d5mp7a2, d5mp7b1, d5mp7b2 |