Lineage for d5mp7c1 (5mp7 C:10-168)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499680Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2499681Protein automated matches [190891] (38 species)
    not a true protein
  7. 2499876Species Mycobacterium smegmatis [TaxId:246196] [333421] (1 PDB entry)
  8. 2499881Domain d5mp7c1: 5mp7 C:10-168 [333422]
    automated match to d3s5ja1
    complexed with act

Details for d5mp7c1

PDB Entry: 5mp7 (more details), 2.4 Å

PDB Description: crystal structure of phosphoribosylpyrophosphate synthetase from mycobacterium smegmatis
PDB Compounds: (C:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5mp7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mp7c1 c.61.1.0 (C:10-168) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
knlmlfagrahpeladqvakeldvavtaqtardfangeifvrfdesvrgcdafvlqshpa
plnqwlmeqlimidalkrgsakritailpfypyarqdkkhrgrepisarlvadllktaga
drivsvdlhtdqiqgffdgpvdhmraqklltgyigehya

SCOPe Domain Coordinates for d5mp7c1:

Click to download the PDB-style file with coordinates for d5mp7c1.
(The format of our PDB-style files is described here.)

Timeline for d5mp7c1: