![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (58 species) not a true protein |
![]() | Species Helicobacter cinaedi [TaxId:213] [333401] (1 PDB entry) |
![]() | Domain d5lbhb_: 5lbh B: [333420] automated match to d2fjcc_ complexed with fe |
PDB Entry: 5lbh (more details), 2.55 Å
SCOPe Domain Sequences for d5lbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lbhb_ a.25.1.0 (B:) automated matches {Helicobacter cinaedi [TaxId: 213]} kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs aayaddkvgelqkaiwmlksqla
Timeline for d5lbhb_: