Lineage for d5lbhb_ (5lbh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704063Species Helicobacter cinaedi [TaxId:213] [333401] (1 PDB entry)
  8. 2704065Domain d5lbhb_: 5lbh B: [333420]
    automated match to d2fjcc_
    complexed with fe

Details for d5lbhb_

PDB Entry: 5lbh (more details), 2.55 Å

PDB Description: crystal structure of helicobacter cinaedi caip
PDB Compounds: (B:) caip

SCOPe Domain Sequences for d5lbhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lbhb_ a.25.1.0 (B:) automated matches {Helicobacter cinaedi [TaxId: 213]}
kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
aayaddkvgelqkaiwmlksqla

SCOPe Domain Coordinates for d5lbhb_:

Click to download the PDB-style file with coordinates for d5lbhb_.
(The format of our PDB-style files is described here.)

Timeline for d5lbhb_: