SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1a79c1 (1a79 C:83-179)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121679Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 2121680Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 protein domains)
  6. 2121707Protein Tetrameric tRNA splicing endonuclease, C-terminal domain [53034] (1 species)
  7. 2121708Species Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry)
  8. 2121711Domain d1a79c1: 1a79 C:83-179 [33342]
    Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2
    complexed with au, so4

Details for d1a79c1

PDB Entry: 1a79 (more details), 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii
PDB Compounds: (C:) tRNA endonuclease

SCOPe Domain Sequences for d1a79c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a79c1 c.52.2.1 (C:83-179) Tetrameric tRNA splicing endonuclease, C-terminal domain {Methanococcus jannaschii [TaxId: 2190]}
erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls
eltgfvrvahsvrkklliaivdadgdivyynmtyvkp

SCOPe Domain Coordinates for d1a79c1:

Click to download the PDB-style file with coordinates for d1a79c1.
(The format of our PDB-style files is described here.)

Timeline for d1a79c1: