![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) ![]() |
![]() | Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins) |
![]() | Protein Tetrameric tRNA splicing endonuclease, C-terminal domain [53034] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry) |
![]() | Domain d1a79c1: 1a79 C:83-179 [33342] Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2 complexed with au, so4 |
PDB Entry: 1a79 (more details), 2.28 Å
SCOPe Domain Sequences for d1a79c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a79c1 c.52.2.1 (C:83-179) Tetrameric tRNA splicing endonuclease, C-terminal domain {Methanococcus jannaschii [TaxId: 2190]} erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls eltgfvrvahsvrkklliaivdadgdivyynmtyvkp
Timeline for d1a79c1: