| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Helicobacter cinaedi [TaxId:213] [333401] (1 PDB entry) |
| Domain d5lbhi_: 5lbh I: [333418] automated match to d2fjcc_ complexed with fe |
PDB Entry: 5lbh (more details), 2.55 Å
SCOPe Domain Sequences for d5lbhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lbhi_ a.25.1.0 (I:) automated matches {Helicobacter cinaedi [TaxId: 213]}
kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
aayaddkvgelqkaiwmlksqla
Timeline for d5lbhi_: