SCOPe 2.07: Domain d1a79b1: 1a79 B:83-179

Lineage for d1a79b1 (1a79 B:83-179)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family)

5. Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)

6. Protein Tetrameric tRNA splicing endonuclease, C-terminal domain [53034] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry)

8. Domain d1a79b1: 1a79 B:83-179 [33341]
   Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2
   complexed with au, so4

Details for d1a79b1

PDB Entry: 1a79, 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii

PDB Compounds: (B:) tRNA endonuclease

SCOPe Domain Sequences for d1a79b1:

Sequence; same for both SEQRES and ATOM records:

>d1a79b1 c.52.2.1 (B:83-179) Tetrameric tRNA splicing endonuclease, C-terminal domain {Methanococcus jannaschii [TaxId: 2190]}
erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls
eltgfvrvahsvrkklliaivdadgdivyynmtyvkp

Timeline for d1a79b1:

• d1a79b1 first appeared (with stable ids) in SCOP 1.55
  
• d1a79b1 appears in SCOPe 2.06
  
• d1a79b1 appears in the current release, SCOPe 2.08