Lineage for d1a79a1 (1a79 A:83-179)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490815Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 2490816Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (3 proteins)
  6. 2490843Protein Tetrameric tRNA splicing endonuclease, C-terminal domain [53034] (1 species)
  7. 2490844Species Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry)
  8. 2490845Domain d1a79a1: 1a79 A:83-179 [33340]
    Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2
    complexed with au, so4

Details for d1a79a1

PDB Entry: 1a79 (more details), 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii
PDB Compounds: (A:) tRNA endonuclease

SCOPe Domain Sequences for d1a79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a79a1 c.52.2.1 (A:83-179) Tetrameric tRNA splicing endonuclease, C-terminal domain {Methanococcus jannaschii [TaxId: 2190]}
erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls
eltgfvrvahsvrkklliaivdadgdivyynmtyvkp

SCOPe Domain Coordinates for d1a79a1:

Click to download the PDB-style file with coordinates for d1a79a1.
(The format of our PDB-style files is described here.)

Timeline for d1a79a1: