SCOP 1.57: Domain d1a79a1: 1a79 A:83-179

Lineage for d1a79a1 (1a79 A:83-179)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.2: tRNA splicing endonuclease, C-terminal domain [53032] (1 family)

5. Family c.52.2.1: tRNA splicing endonuclease, C-terminal domain [53033] (1 protein)

6. Protein tRNA splicing endonuclease, C-terminal domain [53034] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [53035] (1 PDB entry)

8. Domain d1a79a1: 1a79 A:83-179 [33340]
   Other proteins in same PDB: d1a79a2, d1a79b2, d1a79c2, d1a79d2

Details for d1a79a1

PDB Entry: 1a79, 2.28 Å

PDB Description: crystal structure of the trna splicing endonuclease from methanococcus jannaschii

SCOP Domain Sequences for d1a79a1:

Sequence; same for both SEQRES and ATOM records:

>d1a79a1 c.52.2.1 (A:83-179) tRNA splicing endonuclease, C-terminal domain {Archaeon Methanococcus jannaschii}
erlclkylvykdlrtrgyivktglkygadfrlyerganidkehsvylvkvfpedssflls
eltgfvrvahsvrkklliaivdadgdivyynmtyvkp

Timeline for d1a79a1:

• d1a79a1 first appeared (with stable ids) in SCOP 1.55
  
• d1a79a1 appears in SCOP 1.59
  
• d1a79a1 appears in the current release, SCOPe 2.08