Lineage for d5jgga_ (5jgg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2301857Species Acipenser persicus [TaxId:61968] [333390] (2 PDB entries)
  8. 2301858Domain d5jgga_: 5jgg A: [333391]
    Other proteins in same PDB: d5jggb_
    automated match to d1outa_
    complexed with hem, pgo

Details for d5jgga_

PDB Entry: 5jgg (more details), 1.7 Å

PDB Description: x-ray sequence and high resolution crystal structure of persian sturgeon methemoglobin
PDB Compounds: (A:) Alpha chain

SCOPe Domain Sequences for d5jgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jgga_ a.1.1.2 (A:) automated matches {Acipenser persicus [TaxId: 61968]}
tltsadkshvksiwskasgkaeelgaealgrmlevfpntktyfshyadlsvtsgqvhthg
kkildaittavnhidditgvltalstlhaktlrvdpanfkilshtilvvlalyfpadftp
evhlacdkflasvshtlatkyr

SCOPe Domain Coordinates for d5jgga_:

Click to download the PDB-style file with coordinates for d5jgga_.
(The format of our PDB-style files is described here.)

Timeline for d5jgga_: