Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (42 species) not a true protein |
Species Acipenser persicus [TaxId:61968] [333390] (1 PDB entry) |
Domain d5jgga_: 5jgg A: [333391] Other proteins in same PDB: d5jggb_ automated match to d1outa_ complexed with hem, pgo |
PDB Entry: 5jgg (more details), 1.7 Å
SCOPe Domain Sequences for d5jgga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jgga_ a.1.1.2 (A:) automated matches {Acipenser persicus [TaxId: 61968]} tltsadkshvksiwskasgkaeelgaealgrmlevfpntktyfshyadlsvtsgqvhthg kkildaittavnhidditgvltalstlhaktlrvdpanfkilshtilvvlalyfpadftp evhlacdkflasvshtlatkyr
Timeline for d5jgga_: