Lineage for d1fzrd_ (1fzr D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71527Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 71528Superfamily c.52.1: Restriction endonuclease-like [52980] (18 families) (S)
  5. 71686Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
  6. 71687Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
  7. 71688Species Bacteriophage T7 [TaxId:10760] [53031] (1 PDB entry)
  8. 71692Domain d1fzrd_: 1fzr D: [33339]

Details for d1fzrd_

PDB Entry: 1fzr (more details), 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i

SCOP Domain Sequences for d1fzrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzrd_ c.52.1.17 (D:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOP Domain Coordinates for d1fzrd_:

Click to download the PDB-style file with coordinates for d1fzrd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzrd_: