Lineage for d5jhhe2 (5jhh E:942-1081)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412775Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [117254] (1 species)
  7. 2412776Species Human (Homo sapiens) [TaxId:9606] [117255] (5 PDB entries)
    Uniprot O15085 714-1081
  8. 2412782Domain d5jhhe2: 5jhh E:942-1081 [333388]
    Other proteins in same PDB: d5jhha1, d5jhhb_, d5jhhe1, d5jhhf_
    automated match to d1xcga2
    complexed with gol, ra0

Details for d5jhhe2

PDB Entry: 5jhh (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between the human rhoa, its inhibitor and the dh/ph domain of human arhgef11
PDB Compounds: (E:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d5jhhe2:

Sequence, based on SEQRES records: (download)

>d5jhhe2 b.55.1.1 (E:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktavgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelva
ltssdkntwmelleeavrna

Sequence, based on observed residues (ATOM records): (download)

>d5jhhe2 b.55.1.1 (E:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntwm
elleeavrna

SCOPe Domain Coordinates for d5jhhe2:

Click to download the PDB-style file with coordinates for d5jhhe2.
(The format of our PDB-style files is described here.)

Timeline for d5jhhe2: