Lineage for d5jhhe1 (5jhh E:714-941)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004752Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2004753Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2004754Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2004782Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)
  7. 2004783Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries)
    Uniprot O15085 714-1081
  8. 2004789Domain d5jhhe1: 5jhh E:714-941 [333385]
    Other proteins in same PDB: d5jhha2, d5jhhb_, d5jhhe2, d5jhhf_
    automated match to d1xcga1
    complexed with gol, ra0

Details for d5jhhe1

PDB Entry: 5jhh (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between the human rhoa, its inhibitor and the dh/ph domain of human arhgef11
PDB Compounds: (E:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d5jhhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhhe1 a.87.1.1 (E:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
qnwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpre
elarlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfc
syqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesii
khteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

SCOPe Domain Coordinates for d5jhhe1:

Click to download the PDB-style file with coordinates for d5jhhe1.
(The format of our PDB-style files is described here.)

Timeline for d5jhhe1: