Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186896] (17 PDB entries) |
Domain d5jhgf_: 5jhg F: [333384] Other proteins in same PDB: d5jhga1, d5jhga2, d5jhge1, d5jhge2 automated match to d4f38a_ complexed with gol |
PDB Entry: 5jhg (more details), 2.5 Å
SCOPe Domain Sequences for d5jhgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhgf_ c.37.1.8 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
Timeline for d5jhgf_: