![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries) |
![]() | Domain d5ifta4: 5ift A:664-845 [333367] Other proteins in same PDB: d5ifta1, d5ifta2, d5ifta3, d5ifta6 automated match to d1tg7a2 complexed with cl, dms, nag, so4 |
PDB Entry: 5ift (more details), 2.45 Å
SCOPe Domain Sequences for d5ifta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ifta4 b.18.1.0 (A:664-845) automated matches {Aspergillus niger [TaxId: 425011]} apdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssdygf htgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynatynlp qlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnlgge dy
Timeline for d5ifta4: