SCOPe 2.06: Domain d5ifta2: 5ift A:394-566

Lineage for d5ifta2 (5ift A:394-566)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Aspergillus niger [TaxId:425011] [333181] (6 PDB entries)

8. Domain d5ifta2: 5ift A:394-566 [333365]
   Other proteins in same PDB: d5ifta1, d5ifta3, d5ifta4, d5ifta5, d5ifta6
   automated match to d1tg7a4
   complexed with bma, cl, dms, gal, glc, man, nag, so4

Details for d5ifta2

PDB Entry: 5ift, 2.45 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 3-b-galactopyranosyl glucose

PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ifta2:

Sequence; same for both SEQRES and ATOM records:

>d5ifta2 b.71.1.0 (A:394-566) automated matches {Aspergillus niger [TaxId: 425011]}
gyltaspgnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsags
vtipqlggtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehh
elaistksnvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillld

Timeline for d5ifta2:

• d5ifta2 is new in SCOPe 2.06-stable
  
• d5ifta2 appears in SCOPe 2.07
  
• d5ifta2 appears in the current release, SCOPe 2.08