Lineage for d5ifta1 (5ift A:41-393)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2418880Species Aspergillus niger [TaxId:425011] [333178] (6 PDB entries)
  8. 2418886Domain d5ifta1: 5ift A:41-393 [333364]
    Other proteins in same PDB: d5ifta2, d5ifta3, d5ifta4, d5ifta5, d5ifta6
    automated match to d1tg7a5
    complexed with bma, cl, dms, gal, glc, man, nag, so4

Details for d5ifta1

PDB Entry: 5ift (more details), 2.45 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 3-b-galactopyranosyl glucose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5ifta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifta1 c.1.8.0 (A:41-393) automated matches {Aspergillus niger [TaxId: 425011]}
llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvsp

SCOPe Domain Coordinates for d5ifta1:

Click to download the PDB-style file with coordinates for d5ifta1.
(The format of our PDB-style files is described here.)

Timeline for d5ifta1: