| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:521006] [333277] (1 PDB entry) |
| Domain d5v6dn_: 5v6d N: [333363] automated match to d4hr2b_ complexed with cit, edo |
PDB Entry: 5v6d (more details), 1.85 Å
SCOPe Domain Sequences for d5v6dn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v6dn_ d.58.6.1 (N:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
maiertisiikpdavgknvigkiysrfeenglkivaakmkqltlkeaqefyavhkdrpfy
aglvefmtggpvmiqvlegenavlknrelmgatnpteaaegtiradfatsvsinavhgsd
svenaaleiayffsqteicpr
Timeline for d5v6dn_: