Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [333353] (1 PDB entry) |
Domain d5vh6a2: 5vh6 A:281-400 [333354] Other proteins in same PDB: d5vh6a1, d5vh6a3 automated match to d2bv3a1 complexed with cl |
PDB Entry: 5vh6 (more details), 2.61 Å
SCOPe Domain Sequences for d5vh6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vh6a2 b.43.3.0 (A:281-400) automated matches {Bacillus subtilis [TaxId: 224308]} ptdvaaikgtrpdtneeierhssdeepfsalafkvmtdpyvgkltffrvysgtldsgsyv knstkgkrervgrilqmhansreeistvyagdiaaavglkdtttgdtlcdekdlvilesm
Timeline for d5vh6a2: