Lineage for d1f1zb2 (1f1z B:8-168)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994621Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein)
  6. 994622Protein TnsA endonuclease, N-terminal domain [53027] (1 species)
    a catalytic component of the tn7 transposition system
  7. 994623Species Escherichia coli [TaxId:562] [53028] (2 PDB entries)
    Uniprot P13988
  8. 994627Domain d1f1zb2: 1f1z B:8-168 [33335]
    Other proteins in same PDB: d1f1za1, d1f1zb1
    complexed with cl, mg

Details for d1f1zb2

PDB Entry: 1f1z (more details), 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system
PDB Compounds: (B:) tnsa endonuclease

SCOPe Domain Sequences for d1f1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1zb2 c.52.1.16 (B:8-168) TnsA endonuclease, N-terminal domain {Escherichia coli [TaxId: 562]}
fsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelavf
lslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeqf
aiqvkpaaalqdertleklelerrywqqkqipwfiftdkei

SCOPe Domain Coordinates for d1f1zb2:

Click to download the PDB-style file with coordinates for d1f1zb2.
(The format of our PDB-style files is described here.)

Timeline for d1f1zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1zb1