SCOP 1.75: Domain d1f1zb2: 1f1z B:8-168

Lineage for d1f1zb2 (1f1z B:8-168)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families)

5. Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein)

6. Protein TnsA endonuclease, N-terminal domain [53027] (1 species)
   a catalytic component of the tn7 transposition system

7. Species Escherichia coli [TaxId:562] [53028] (2 PDB entries)
   Uniprot P13988

8. Domain d1f1zb2: 1f1z B:8-168 [33335]
   Other proteins in same PDB: d1f1za1, d1f1zb1
   complexed with cl, mg

Details for d1f1zb2

PDB Entry: 1f1z, 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

PDB Compounds: (B:) tnsa endonuclease

SCOP Domain Sequences for d1f1zb2:

Sequence; same for both SEQRES and ATOM records:

>d1f1zb2 c.52.1.16 (B:8-168) TnsA endonuclease, N-terminal domain {Escherichia coli [TaxId: 562]}
fsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelavf
lslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeqf
aiqvkpaaalqdertleklelerrywqqkqipwfiftdkei

Timeline for d1f1zb2:

• d1f1zb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f1zb2 appears in SCOP 1.73
  
• d1f1zb2 appears in SCOPe 2.01
  
• d1f1zb2 appears in the current release, SCOPe 2.08