| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins) |
| Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries) |
| Domain d5wvcc_: 5wvc C: [333348] Other proteins in same PDB: d5wvcb1, d5wvcb2, d5wvcd1, d5wvcd2, d5wvcf1, d5wvcf2 automated match to d3ygsc_ complexed with iod |
PDB Entry: 5wvc (more details), 2.99 Å
SCOPe Domain Sequences for d5wvcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wvcc_ a.77.1.3 (C:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvs
Timeline for d5wvcc_: