![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins) |
![]() | Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries) |
![]() | Domain d5wvca_: 5wvc A: [333347] Other proteins in same PDB: d5wvcb1, d5wvcb2, d5wvcd1, d5wvcd2, d5wvcf1, d5wvcf2 automated match to d3ygsc_ complexed with iod |
PDB Entry: 5wvc (more details), 2.99 Å
SCOPe Domain Sequences for d5wvca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wvca_ a.77.1.3 (A:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]} mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi lkkdndsyvsfynallhegykdlaallhdgipvvs
Timeline for d5wvca_: