SCOPe 2.08: Domain d5uxqb2: 5uxq B:109-213

Lineage for d5uxqb2 (5uxq B:109-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5uxqb2: 5uxq B:109-213 [333340]
   Other proteins in same PDB: d5uxqa_, d5uxqb1, d5uxqh_, d5uxql1
   automated match to d1t3fa2

Details for d5uxqb2

PDB Entry: 5uxq, 2.42 Å

PDB Description: structure of anti-hiv trimer apex antibody pgt143

PDB Compounds: (B:) PGT143 Fab Light Chain

SCOPe Domain Sequences for d5uxqb2:

Sequence; same for both SEQRES and ATOM records:

>d5uxqb2 b.1.1.2 (B:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5uxqb2:

• d5uxqb2 first appeared in SCOPe 2.06
  
• d5uxqb2 appears in SCOPe 2.07