Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein automated matches [319939] (2 species) not a true protein |
Species Diaphorobacter sp. [TaxId:1302548] [319940] (1 PDB entry) |
Domain d5xbpd2: 5xbp D:153-445 [333333] Other proteins in same PDB: d5xbpa1, d5xbpc_, d5xbpd1, d5xbpf_, d5xbpg1, d5xbpi_ automated match to d1eg9a2 complexed with fe, fes |
PDB Entry: 5xbp (more details), 2.9 Å
SCOPe Domain Sequences for d5xbpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xbpd2 d.129.3.3 (D:153-445) automated matches {Diaphorobacter sp. [TaxId: 1302548]} eapplidylgdaawymeptfkhsgglelvgppgkvvvkanwktfaenfvgdiyhvgwtha silrvgqsvftplagnamlppegsglqmtskygsgmslmwdyyagnhsadlvpdlmafgg akqeklakeigdvrariyrshlngtifpnnsfltgsaafkvwnpidenttevwtyafvek dmpedlkrrladavqrtvgpggywesddndnmetlsqnakkyqssnsdliaslgfgkdvy gdecypgvvgpsgasetsyrgfyrayqahisssnwaefenasrnwhteltktt
Timeline for d5xbpd2: