| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (13 species) not a true protein |
| Species Diaphorobacter sp. [TaxId:1302548] [319937] (2 PDB entries) |
| Domain d5xbpa1: 5xbp A:2-152 [333330] Other proteins in same PDB: d5xbpa2, d5xbpc_, d5xbpd2, d5xbpf_, d5xbpg2, d5xbpi_ automated match to d1o7na1 complexed with fe, fes |
PDB Entry: 5xbp (more details), 2.9 Å
SCOPe Domain Sequences for d5xbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xbpa1 b.33.1.0 (A:2-152) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
ygdaikkkclglkevpriesfhgfiygcfda
Timeline for d5xbpa1: