Lineage for d5vfba_ (5vfb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424043Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2424044Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2424086Protein automated matches [195320] (5 species)
    not a true protein
  7. 2424101Species Pseudomonas aeruginosa [TaxId:208964] [333295] (2 PDB entries)
  8. 2424102Domain d5vfba_: 5vfb A: [333329]
    automated match to d3s9za_
    complexed with cl, goa, na, ni

Details for d5vfba_

PDB Entry: 5vfb (more details), 1.36 Å

PDB Description: 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d5vfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfba_ c.1.13.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tervqvgglqvakvlfdfvnneaipgtgvsadtfwtgaeavindlapknkallakrdelq
akidgwhqaragqahdavaykafleeigyllpeaedfqagtqnvddeiarmagpqlvvpv
mnarfalnasnarwgslydalygtdviseeggaekgkgynkvrgdkviafarafldeaap
lesgshvdatsysvkngalvvalkngsetglknagqflafqgdaakpqavllkhnglhfe
iqidpsspvgqtdaagvkdvlmeaalttimdcedsvaavdaddkvviyrnwlglmkgdla
eevskggstftrtmnpdrvytradgseltlhgrsllfvrnvghlmtndaildkdgnevpe
giqdglftsliaihdlngntsrknsrtgsvyivkpkmhgpeeaaftnelfgrvedvlglp
rntlkvgimdeerrttvnlkacikaakdrvvfintgfldrtgdeihtsmeagavvrkgam
ksekwigayennnvdvglatglqgkaqigkgmwampdlmaamleqkighplagantawvp
sptaatlhalhyhkvdvfarqaelakrtpasvddiltiplapntnwtaeeiknevdnnaq
gilgyvvrwidqgvgcskvpdindvglmedratlrissqllanwlrhgvisqeqvveslk
rmavvvdrqnasdpsyrpmapnfddnvafqaalelvvegtrqpngytepvlhrrrrefka
kngl

SCOPe Domain Coordinates for d5vfba_:

Click to download the PDB-style file with coordinates for d5vfba_.
(The format of our PDB-style files is described here.)

Timeline for d5vfba_: