Lineage for d5wvce_ (5wvc E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719000Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)
  6. 2719001Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. 2719002Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)
  8. 2719012Domain d5wvce_: 5wvc E: [333321]
    Other proteins in same PDB: d5wvcb1, d5wvcb2, d5wvcd1, d5wvcd2, d5wvcf1, d5wvcf2
    automated match to d3ygsc_
    complexed with iod

Details for d5wvce_

PDB Entry: 5wvc (more details), 2.99 Å

PDB Description: structure of the card-card disk
PDB Compounds: (E:) Apoptotic protease-activating factor 1

SCOPe Domain Sequences for d5wvce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvce_ a.77.1.3 (E:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvv

SCOPe Domain Coordinates for d5wvce_:

Click to download the PDB-style file with coordinates for d5wvce_.
(The format of our PDB-style files is described here.)

Timeline for d5wvce_: