Lineage for d5wvcb1 (5wvc B:201-301)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004166Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2004167Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2004235Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)
  6. 2004262Protein automated matches [190343] (1 species)
    not a true protein
  7. 2004263Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries)
  8. 2004267Domain d5wvcb1: 5wvc B:201-301 [333318]
    Other proteins in same PDB: d5wvca_, d5wvcb2, d5wvcc_, d5wvcd2, d5wvce_, d5wvcf2
    automated match to d4rhwe_
    complexed with iod

Details for d5wvcb1

PDB Entry: 5wvc (more details), 2.99 Å

PDB Description: structure of the card-card disk
PDB Compounds: (B:) Caspase

SCOPe Domain Sequences for d5wvcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvcb1 a.77.1.3 (B:201-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqaaklskp

SCOPe Domain Coordinates for d5wvcb1:

Click to download the PDB-style file with coordinates for d5wvcb1.
(The format of our PDB-style files is described here.)

Timeline for d5wvcb1: