| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins) |
| Protein automated matches [190343] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries) |
| Domain d5wvcd1: 5wvc D:201-301 [333315] Other proteins in same PDB: d5wvca_, d5wvcb2, d5wvcc_, d5wvcd2, d5wvce_, d5wvcf2 automated match to d4rhwe_ complexed with iod |
PDB Entry: 5wvc (more details), 2.99 Å
SCOPe Domain Sequences for d5wvcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wvcd1 a.77.1.3 (D:201-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqaaklskp
Timeline for d5wvcd1: