SCOPe 2.08: Domain d5wvcd1: 5wvc D:201-301

Lineage for d5wvcd1 (5wvc D:201-301)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)

6. Protein automated matches [190343] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries)

8. Domain d5wvcd1: 5wvc D:201-301 [333315]
   Other proteins in same PDB: d5wvca_, d5wvcb2, d5wvcc_, d5wvcd2, d5wvce_, d5wvcf2
   automated match to d4rhwe_
   complexed with iod

Details for d5wvcd1

PDB Entry: 5wvc, 2.99 Å

PDB Description: structure of the card-card disk

PDB Compounds: (D:) Caspase

SCOPe Domain Sequences for d5wvcd1:

Sequence; same for both SEQRES and ATOM records:

>d5wvcd1 a.77.1.3 (D:201-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqaaklskp

Timeline for d5wvcd1:

• d5wvcd1 first appeared in SCOPe 2.06
  
• d5wvcd1 appears in SCOPe 2.07