SCOPe 2.08: Domain d5v8sb2: 5v8s B:251-398

Lineage for d5v8sb2 (5v8s B:251-398)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [333312] (1 PDB entry)

8. Domain d5v8sb2: 5v8s B:251-398 [333313]
   Other proteins in same PDB: d5v8sa1, d5v8sa3, d5v8sb1, d5v8sb3
   automated match to d1vmea1
   complexed with act, cl, feo, mrd; mutant

Details for d5v8sb2

PDB Entry: 5v8s, 1.41 Å

PDB Description: flavo di-iron protein h90d mutant from thermotoga maritima

PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d5v8sb2:

Sequence, based on SEQRES records:

>d5v8sb2 c.23.5.0 (B:251-398) automated matches {Thermotoga maritima [TaxId: 243274]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Sequence, based on observed residues (ATOM records):

>d5v8sb2 c.23.5.0 (B:251-398) automated matches {Thermotoga maritima [TaxId: 243274]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwaertagellketkfrilsf
teikgsnmderkieeaisllkkele

Timeline for d5v8sb2:

• d5v8sb2 first appeared in SCOPe 2.06
  
• d5v8sb2 appears in SCOPe 2.07