Lineage for d5v8sb2 (5v8s B:251-398)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857116Species Thermotoga maritima [TaxId:243274] [333312] (1 PDB entry)
  8. 2857118Domain d5v8sb2: 5v8s B:251-398 [333313]
    Other proteins in same PDB: d5v8sa1, d5v8sa3, d5v8sb1, d5v8sb3
    automated match to d1vmea1
    complexed with act, cl, feo, mrd; mutant

Details for d5v8sb2

PDB Entry: 5v8s (more details), 1.41 Å

PDB Description: flavo di-iron protein h90d mutant from thermotoga maritima
PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d5v8sb2:

Sequence, based on SEQRES records: (download)

>d5v8sb2 c.23.5.0 (B:251-398) automated matches {Thermotoga maritima [TaxId: 243274]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Sequence, based on observed residues (ATOM records): (download)

>d5v8sb2 c.23.5.0 (B:251-398) automated matches {Thermotoga maritima [TaxId: 243274]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwaertagellketkfrilsf
teikgsnmderkieeaisllkkele

SCOPe Domain Coordinates for d5v8sb2:

Click to download the PDB-style file with coordinates for d5v8sb2.
(The format of our PDB-style files is described here.)

Timeline for d5v8sb2: