Lineage for d2azob_ (2azo B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397006Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) (S)
  5. 397167Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (1 protein)
  6. 397168Protein DNA mismatch repair protein MutH from [53021] (1 species)
  7. 397169Species Escherichia coli [TaxId:562] [53022] (2 PDB entries)
  8. 397172Domain d2azob_: 2azo B: [33331]

Details for d2azob_

PDB Entry: 2azo (more details), 2.3 Å

PDB Description: dna mismatch repair protein muth from e. coli

SCOP Domain Sequences for d2azob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azob_ c.52.1.14 (B:) DNA mismatch repair protein MutH from {Escherichia coli}
qprpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvlleiwlgas
agskpeqdfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhklkrvlw
ipvegersiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarhgeylq
irpkaanakalteaigargeriltlprgfylkknftsallarhfliq

SCOP Domain Coordinates for d2azob_:

Click to download the PDB-style file with coordinates for d2azob_.
(The format of our PDB-style files is described here.)

Timeline for d2azob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2azoa_