Lineage for d5v6dp_ (5v6d P:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194613Protein automated matches [190032] (18 species)
    not a true protein
  7. 2194771Species Neisseria gonorrhoeae [TaxId:521006] [333277] (1 PDB entry)
  8. 2194787Domain d5v6dp_: 5v6d P: [333300]
    automated match to d4hr2b_
    complexed with cit, edo

Details for d5v6dp_

PDB Entry: 5v6d (more details), 1.85 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate
PDB Compounds: (P:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5v6dp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v6dp_ d.58.6.1 (P:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
maiertisiikpdavgknvigkiysrfeenglkivaakmkqltlkeaqefyavhkdrpfy
aglvefmtggpvmiqvlegenavlknrelmgatnpteaaegtiradfatsvsinavhgsd
svenaaleiayffsqteicpr

SCOPe Domain Coordinates for d5v6dp_:

Click to download the PDB-style file with coordinates for d5v6dp_.
(The format of our PDB-style files is described here.)

Timeline for d5v6dp_: