![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:521006] [333277] (1 PDB entry) |
![]() | Domain d5v6dp_: 5v6d P: [333300] automated match to d4hr2b_ complexed with cit, edo |
PDB Entry: 5v6d (more details), 1.85 Å
SCOPe Domain Sequences for d5v6dp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v6dp_ d.58.6.1 (P:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} maiertisiikpdavgknvigkiysrfeenglkivaakmkqltlkeaqefyavhkdrpfy aglvefmtggpvmiqvlegenavlknrelmgatnpteaaegtiradfatsvsinavhgsd svenaaleiayffsqteicpr
Timeline for d5v6dp_: